Search Thermo Fisher Scientific
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
FIGURE: 1 / 3
ACACB Antibody (PA5-114376) in IHC (P)
Immunohistochemistry analysis of ACACB in paraffin-embedded rat testis tissue. Antigen retrieval was performed with citrate buffer (pH6, 20 min). Samples were blocked with 10% goat serum and incubated in ACACB polyclonal antibody (Product # PA5-114376) at a dilution of 1 µg/mL (overnight, 4°C), followed by biotinylated goat anti-rabbit IgG (30 min, 37°C) and Strepavidin-Biotin-Complex (SABC) with DAB.
Product Details
PA5-114376
Applications
Tested Dilution
Publications
Product Specifications
Species Reactivity
Human,
Mouse,
Rat
Host/Isotype
Rabbit
/ IgG
Class
Polyclonal
Type
Antibody
Immunogen
A synthetic peptide corresponding to a sequence of human Acetyl Coenzyme A Carboxylase/ACACB (EENPEVAVDCVIYLSQHISPAERAQVVHLLSTMD).
Conjugate
Form
Lyophilized
Concentration
500 µg/mL
Purification
Affinity chromatography
Storage buffer
PBS with 4mg trehalose
Contains
0.05mg sodium azide
Storage conditions
-20°C
Shipping conditions
Wet ice
RRID
AB_2884832
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Positive Control - WB: rat skeletal muscle tissue, mouse skeletal muscle tissue. IHC: rat testis tissue. Flow: HL-60 cell.|Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.
Target Information
Catalyzes the ATP-dependent carboxylation of acetyl-CoA to malonyl-CoA. Carries out three functions: biotin carboxyl carrier protein, biotin carboxylase and carboxyltransferase. Involved in inhibition of fatty acid and glucose oxidation and enhancement of fat storage. May play a role in regulation of mitochondrial fatty acid oxidation through malonyl-CoA-dependent inhibition of carnitine palmitoyltransferase 1.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: ACC-beta; Acetyl-CoA carboxylase 2; acetyl-Coenzyme A carboxylase 2; acetyl-Coenzyme A carboxylase beta
Gene Aliases: ACACB; ACC2; ACCB; AI597064; AW743042; HACC275
UniProt ID: (Human) O00763, (Mouse) E9Q4Z2
Entrez Gene ID: (Human) 32, (Rat) 116719, (Mouse) 100705
acetyl-CoA metabolic process
fatty acid biosynthetic process
positive regulation of lipid storage
response to organic cyclic compound
response to drug
negative regulation of fatty acid oxidation
protein homotetramerization
positive regulation of heart growth
malonyl-CoA biosynthetic process
lipid metabolic process
fatty acid metabolic process
metabolic process
biotin metabolic process
carnitine shuttle
negative regulation of gene expression
regulation of glucose metabolic process
positive regulation of cellular metabolic process
response to nutrient levels
negative regulation of fatty acid beta-oxidation
negative regulation of catalytic activity
energy homeostasis
Performance Guarantee
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn more
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support