Search Thermo Fisher Scientific
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
FIGURE: 1 / 1
ASIC2 Antibody (PA5-95378) in WB
Western blot analysis of ASIC2 in rat testis extract (lane 1) and MCF-7 whole cell lysates (lane 2). Samples were incubated with ASIC2 polyclonal antibody (Product # PA5-95378) using a 0.5 µg/mL dilution. developed was performed using enhanced chemiluminescence (ECL).
Product Details
PA5-95378
Product Specifications
Species Reactivity
Human,
Rat
Host/Isotype
Rabbit
/ IgG
Class
Polyclonal
Type
Antibody
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human ACCN1 (112-147aa ELLALLDVNLQIPDPHLADPSVLEALRQKANFKHYK).
Conjugate
Form
Lyophilized
Concentration
500 µg/mL
Purification
Affinity chromatography
Storage buffer
PBS with 5mg BSA
Contains
0.05mg sodium azide
Storage conditions
-20°C
Shipping conditions
Ambient (domestic); Wet ice (international)
RRID
AB_2807181
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Positive Control - WB: rat testis tissue, MCF-7 whole cell.|Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.
Target Information
ACCN1 encodes a member of the degenerin/epithelial sodium channel (DEG/ENaC) superfamily. The members of this family are amiloride-sensitive sodium channels that contain intracellular N and C termini, 2 hydrophobic transmembrane regions, and a large extracellular loop, which has many cysteine residues with conserved spacing. The member encoded by this protein may play a role in neurotransmission. In addition, a heteromeric association between this member and ACCN3 (variant 1) has been observed to co-assemble into proton-gated channels sensitive to gadolinium.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: acid sensing (proton gated) ion channel 2; acid sensing ion channel 2; acid-sensing (proton-gated) ion channel 2; Acid-sensing ion channel 2; Amiloride-sensitive brain sodium channel; Amiloride-sensitive brain sodium channel 2; Amiloride-sensitive cation channel 1, neuronal; Amiloride-sensitive cation channel neuronal 1; ASIC2; BNC1; Brain sodium channel 1; degenerin; Mammalian degenerin homolog; MDEG; neuronal amiloride-sensitive cation channel 1
Gene Aliases: ACCN; ACCN1; ASIC2; ASIC2a; BNAC1; BNC1; BNC1k; hBNaC1; MDEG; MDEG1; MDEG2
UniProt ID: (Human) Q16515, (Rat) Q62962
Entrez Gene ID: (Human) 40, (Rat) 25364
regulation of systemic arterial blood pressure by aortic arch baroreceptor feedback
cation transport
sodium ion transport
phototransduction
sensory perception of sound
response to mechanical stimulus
response to acidic pH
regulation of gene expression
regulation of vasoconstriction
regulation of blood coagulation
ion transmembrane transport
regulation of ion transmembrane transport
protein localization to synapse
cellular response to drug
sodium ion transmembrane transport
regulation of membrane potential
negative regulation of apoptotic process
sensory perception of sour taste
detection of mechanical stimulus involved in sensory perception
positive regulation of synapse assembly
cellular response to acidic pH
cation transmembrane transport
positive regulation of cation channel activity
chemical synaptic transmission
central nervous system development
peripheral nervous system development
monovalent inorganic cation transport
Performance Guarantee
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn more
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support