Search Thermo Fisher Scientific
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
FIGURE: 1 / 11
CDC20 Antibody (PA5-79013) in ICC/IF
Immunocytochemistry analysis of Cdc20 using anti-Cdc20 antibody (Product # PA5-79013) . Cdc20 was detected in a section of NIH3T3 cell. Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent for 15 mins. The cells were blocked with 10% goat serum and then incubated with 2μg/mL rabbit anti-Cdc20 antibody (Product # PA5-79013) overnight at 4°C. DyLight®488 Conjugated Goat Anti-Rabbit IgG was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37°C. Visualize using a fluorescence microscope ... View More
Product Details
PA5-79013
Applications
Tested Dilution
Publications
Product Specifications
Species Reactivity
Human,
Mouse,
Rat
Host/Isotype
Rabbit
/ IgG
Class
Polyclonal
Type
Antibody
Immunogen
A synthetic peptide corresponding to a sequence of human Cdc20 (QTPTKKEHQKAWALNLNGFDVEEAKILRLSGKPQNAPEGYQNRLKVLYSQKAT).
Conjugate
Form
Lyophilized
Concentration
500 µg/mL
Purification
Antigen affinity chromatography
Storage buffer
PBS with 4mg trehalose
Contains
0.05mg sodium azide
Storage conditions
-20°C
Shipping conditions
Wet ice
RRID
AB_2746129
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Positive Control - WB: human Hela whole cell. IHC: human colon cancer tissue, human lung cancer tissue, mouse small intestine tissue, rat small intestine tissue, human mammary cancer tissue. ICC/IF: NIH3T3 cell. Flow: SiHa cell, U20S cell.
Target Information
Required for full ubiquitin ligase activity of the anaphase promoting complex/cyclosome (APC/C) and may confer substrate specificity upon the complex. Is regulated by MAD2L1: in metaphase the MAD2L1-CDC20-APC/C ternary complex is inactive and in anaphase the CDC20-APC/C binary complex is active in degrading substrates. The CDC20-APC/C complex positively regulates the formation of synaptic vesicle clustering at active zone to the presynaptic membrane in postmitotic neurons. CDC20-APC/C-induced degradation of NEUROD2 induces presynaptic differentiation.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: CDC20 cell division cycle 20 homolog; cell cycle protein p55CDC; cell division cycle 20 homolog; Cell division cycle protein 20 homolog; mmCdc20; p55CDC
Gene Aliases: 2310042N09Rik; bA276H19.3; C87100; CDC20; CDC20A; p55CDC
UniProt ID: (Human) Q12834, (Rat) Q62623, (Mouse) Q9JJ66
Entrez Gene ID: (Human) 991, (Rat) 64515, (Mouse) 107995
cell cycle
sister chromatid cohesion
mitotic nuclear division
positive regulation of cell proliferation
anaphase-promoting complex-dependent catabolic process
positive regulation of synaptic plasticity
regulation of meiotic nuclear division
protein ubiquitination involved in ubiquitin-dependent protein catabolic process
proteasome-mediated ubiquitin-dependent protein catabolic process
regulation of dendrite development
cell division
negative regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle
positive regulation of ubiquitin-protein ligase activity involved in regulation of mitotic cell cycle transition
regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle
positive regulation of synapse maturation
positive regulation of ubiquitin protein ligase activity
protein ubiquitination
nervous system development
cell differentiation
Performance Guarantee
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn more
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support