Search Thermo Fisher Scientific
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
FIGURE: 1 / 5
FABP2 Antibody (PA5-79230) in ICC/IF
Immunocytochemistry analysis of Intestinal FABP using anti-Intestinal FABP antibody (Product # PA5-79230) . Intestinal FABP was detected in a section of A431 cells. Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent for 15 mins. The cells were blocked with 10% goat serum and then incubated with 2μg/mL rabbit anti-Intestinal FABP antibody (Product # PA5-79230) overnight at 4°C. DyLight®488 Conjugated Goat Anti-Rabbit IgG was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37°C. The... View More
Product Details
PA5-79230
Applications
Tested Dilution
Publications
Product Specifications
Species Reactivity
Human,
Mouse,
Rat
Host/Isotype
Rabbit
/ IgG
Class
Polyclonal
Type
Antibody
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human FABP2/I-FABP (2-38aa AFDSTWKVDRSENYDKFMEKMGVNIVKRKLAAHDNLK).
Conjugate
Form
Lyophilized
Concentration
500 µg/mL
Purification
Antigen affinity chromatography
Storage buffer
PBS with 5mg BSA
Contains
0.05mg sodium azide
Storage conditions
-20°C
Shipping conditions
Ambient (domestic); Wet ice (international)
RRID
AB_2746346
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Positive Control - WB: SW620 whole cell. IHC: mouse intestine tissue, rat intestine tissue, human intestinal cancer tissue. ICC/IF: A431 cell.
Target Information
The FABP2 gene encodes the intestinal fatty acid-binding protein 2 (I-FABP), which plays a significant role in lipid metabolism by facilitating the transport and intracellular trafficking of long-chain fatty acids in enterocytes, the absorptive cells in the intestine. FABP2 is involved in the uptake, metabolism, and transfer of fatty acids across cellular membranes, contributing to digestion and absorption processes in the intestine. This protein is crucial for efficient lipid metabolism, influencing fatty acid oxidation, and energy balance. Variations in the FABP2 gene have been associated with metabolic traits, such as insulin sensitivity, lipid profiles, and obesity, suggesting its impact on metabolic health. FABP2's function in intestinal lipid absorption and metabolism makes it a subject of interest in studies related to dietary effects on health and the development of metabolic disorders. Understanding FABP2's role is essential for insights into nutritional influences on health and possible therapeutic targets for metabolic diseases.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: FABPI; fatty acid binding protein 1; fatty acid binding protein 2, intestinal; Fatty acid-binding protein 2; Fatty acid-binding protein, intestinal; I-FABP; intestinal fatty acid binding protein; intestinal fatty acid binding protein 2; Intestinal-type fatty acid-binding protein; MGC133132
Gene Aliases: FABP; FABP2; FABPI; I-FABP
UniProt ID: (Human) P12104, (Mouse) P55050, (Rat) P02693
Entrez Gene ID: (Human) 2169, (Mouse) 14079, (Rat) 25598
Performance Guarantee
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn more
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support