Search Thermo Fisher Scientific
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
FIGURE: 1 / 1
HOXB1 Antibody (PA5-95453) in WB
Western blot analysis of HOXA1/HOXB1/HOXD1 in Lane 1: rat testis tissue lysate, Lane 2: mouse testis tissue lysate, Lane 3: human MCF-7 whole cell lysate. Electrophoresis was performed with 5-20% SDS-PAGE gel (70V, Stacking gel; 90V Resolving gel, Time: 2-3 hours), transferred to a nitrocellulose membrane and blocked using 5% Non-fat Milk/TBS (1.5 hrs at room temperature). Samples were incubated with HOXA1/HOXB1/HOXD1 polyclonal antibody (Product # PA5-95453) using a 0.5 µg/mL dilution, followed by a goat anti-rabbit IgG-HRP at a dilution ... View More
Product Details
PA5-95453
Product Specifications
Species Reactivity
Human,
Mouse,
Rat
Host/Isotype
Rabbit
/ IgG
Class
Polyclonal
Type
Antibody
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human HOXB1 (176-220aa TARTFDWMKVKRNPPKTAKVSEPGLGSPSGLRTNFTTRQLTELEK).
Conjugate
Form
Lyophilized
Concentration
500 µg/mL
Purification
Affinity chromatography
Storage buffer
PBS with 4mg trehalose
Contains
0.05mg sodium azide
Storage conditions
-20°C
Shipping conditions
Wet ice
RRID
AB_2807256
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Positive Control - WB: rat testis tissue, mouse testis tissue, human MCF-7 whole cell.|Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.
Target Information
Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis. Acts on the anterior body structures.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: homeo box B1; Homeobox protein Hox-2.9; Homeobox protein Hox-2I; Homeobox protein Hox-B1; Hox-29
Gene Aliases: HCFP3; Hox-2.9; HOX2; HOX2I; Hoxb-1; HOXB1
UniProt ID: (Human) P14653, (Mouse) P17919
Entrez Gene ID: (Human) 3211, (Mouse) 15407, (Rat) 303491
transcription, DNA-templated
regulation of transcription, DNA-templated
multicellular organism development
pattern specification process
anterior/posterior pattern specification
rhombomere 4 development
rhombomere 5 development
facial nerve structural organization
facial nucleus development
positive regulation of transcription from RNA polymerase II promoter
anatomical structure formation involved in morphogenesis
embryonic skeletal system morphogenesis
anatomical structure morphogenesis
rhombomere development
Performance Guarantee
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn more
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support