Search Thermo Fisher Scientific
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
FIGURE: 1 / 10
KDM5B Antibody (PA5-95382) in ICC/IF
Immunocytochemistry analysis of KD.M5B using anti-KD.M5B antibody (Product # PA5-95382) . KD.M5B was detected in a section of MCF-7 cells. Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent for 15 mins. The cells were blocked with 10% goat serum and then incubated with 2μg/mL rabbit anti-KD.M5B antibody (Product # PA5-95382) overnight at 4°C. DyLight®488 Conjugated Goat Anti-Rabbit IgG was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37°C. The section was counterstained with DA... View More
Product Details
PA5-95382
Applications
Tested Dilution
Publications
Product Specifications
Species Reactivity
Human,
Mouse,
Non-human primate,
Rat
Host/Isotype
Rabbit
/ IgG
Class
Polyclonal
Type
Antibody
Immunogen
A synthetic peptide corresponding to a sequence in the middle region of human KDM5B (641-685aa DVLDVVVASTVQKDMAIMIEDEKALRETVRKLGVIDSERMDFE LL).
Conjugate
Form
Lyophilized
Concentration
500 µg/mL
Purification
Affinity chromatography
Storage buffer
PBS with 5mg BSA
Contains
0.05mg sodium azide
Storage conditions
-20°C
Shipping conditions
Ambient (domestic); Wet ice (international)
RRID
AB_2807185
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Positive Control - WB: monkey COS-7 whole cell, human SH-SY5Y whole cell, rat testis tissue, mouse testis tissue. IHC: human intestinal cancer tissue, human intestinal cancer tissue, human lung cancer tissue, human breast cancer tissue, mouse testis tissue, rat testis tissue. ICC/IF: MCF-7 cell. Flow: U20S cell.|Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.
Target Information
KDM5B is a histone demethylase that demethylates 'Lys-4' of histone H3, thereby playing a central role in histone code. It does not demethylate histone H3 'Lys-9' or H3 'Lys-27'. KDM5B demethylates trimethylated, dimethylated and monomethylated H3 'Lys-4'. It acts as a transcriptional corepressor for FOXG1B and PAX9. It favors the proliferation of breast cancer cells by repressing tumor suppressor genes such as BRCA1 and HOXA5. In contrast, KDM5B may act as a tumor suppressor for melanoma.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: [histone H3]-trimethyl-L-lysine(4) demethylase 5B; Cancer/testis antigen 31; CT31; Histone demethylase JARID1B; jumonji, AT rich interactive domain 1B; jumonji, AT rich interactive domain 1B (Rbp2 like); Jumonji, AT rich interactive domain 1B (RBP2-like); Jumonji/ARID domain-containing protein 1B; lysine (K)-specific demethylase 5B; Lysine-specific demethylase 5B; PLU-1; protein phosphatase 1, regulatory subunit 98; putative DNA/chromatin binding motif; putative DNA/chromatin binding motif 1; RBP2-H1; Retinoblastoma-binding protein 2 homolog 1; retinoblastoma-binding protein 2, homolog 1A
Gene Aliases: 2010009J12Rik; 2210016I17Rik; AW556288; CT31; D1Ertd202e; JARID1B; KDM5B; Kiaa4034; mKIAA4034; PLU-1; PLU1; PPP1R98; PUT1; Rb-Bp2; RBBP2H1; RBBP2H1A; RBP2-H1; RGD1565602
UniProt ID: (Human) Q9UGL1, (Mouse) Q80Y84
Entrez Gene ID: (Human) 10765, (Rat) 304809, (Mouse) 75605
DNA binding
transcription factor activity, sequence-specific DNA binding
transcription corepressor activity
protein binding
zinc ion binding
oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, 2-oxoglutarate as one donor, and incorporation of one atom each of oxygen into both donors
histone demethylase activity
histone demethylase activity (H3-K4 specific)
histone demethylase activity (H3-trimethyl-K4 specific)
histone demethylase activity (H3-dimethyl-K4 specific)
molecular_function
sulfonate dioxygenase activity
oxidoreductase activity
2,4-dichlorophenoxyacetate alpha-ketoglutarate dioxygenase activity
procollagen-proline dioxygenase activity
hypophosphite dioxygenase activity
DNA-N1-methyladenine dioxygenase activity
metal ion binding
dioxygenase activity
C-19 gibberellin 2-beta-dioxygenase activity
C-20 gibberellin 2-beta-dioxygenase activity
transcription, DNA-templated
single fertilization
post-embryonic development
positive regulation of gene expression
positive regulation of mammary gland epithelial cell proliferation
histone H3-K4 demethylation
histone H3-K4 demethylation, trimethyl-H3-K4-specific
cellular response to fibroblast growth factor stimulus
negative regulation of transcription, DNA-templated
rhythmic process
oxidation-reduction process
branching involved in mammary gland duct morphogenesis
mammary duct terminal end bud growth
response to fungicide
uterus morphogenesis
lens fiber cell differentiation
regulation of estradiol secretion
regulation of transcription, DNA-templated
chromatin modification
regulation of circadian rhythm
negative regulation of nucleic acid-templated transcription
Performance Guarantee
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn more
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support