Search Thermo Fisher Scientific
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
FIGURE: 1 / 6
MORC3 Antibody (PA5-143951) in ICC/IF
Immunocytochemistry analysis of MORC3 in A431 cells. Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent for 15 mins. The cells were blocked with 10% goat serum. Samples were then incubated in MORC3 Polyclonal antibody (Product # PA5-143951) using a dilution of 2 μg/mL. DyLight®488 conjugated Goat Anti-Rabbit IgG was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37°C. The section was counterstained with DAPI. Visualize using a fluorescence microscope and filter sets appropriate f... View More
Product Details
PA5-143951
Applications
Tested Dilution
Publications
Product Specifications
Species Reactivity
Human,
Mouse,
Rat
Host/Isotype
Rabbit
/ IgG
Class
Polyclonal
Type
Antibody
Immunogen
A synthetic peptide corresponding to a sequence of human MORC3 (ESLKLRSLRVNVGQLLAMIVPDLDLQQVNYDVD).
Conjugate
Form
Lyophilized
Concentration
500 µg/mL
Purification
Antigen affinity chromatography
Storage buffer
PBS with 4mg trehalose
Contains
0.05mg sodium azide
Storage conditions
-20°C
Shipping conditions
Wet ice
RRID
AB_3075165
Product Specific Information
Adding 0.2 mL of distilled water will yield a concentration of 500 µg/mL.
Positive Control - WB: rat heart tissue, rat liver tissue, mouse heart tissue. IHC: human mammary cancer tissue, human rectal cancer tissue. ICC/IF: A431 cell. Flow: A431 cell.|Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.
Target Information
This gene encodes a protein that localizes to the nuclear matrix. The protein also has RNA binding activity, and has a predicted coiled coil domain.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: microrchidia 3; MORC family CW-type zinc finger protein 3; Nuclear matrix protein 2; nuclear matrix protein NXP2; Zinc finger CW-type coiled-coil domain protein 3; zinc finger, CW type with coiled-coil domain 3; zinc finger, CW-type with coiled-coil domain 3
Gene Aliases: 1110051N18Rik; AI452146; BF318192; D16Jhu32e; KIAA0136; MORC3; NXP2; ZCW5; ZCWCC3
UniProt ID: (Human) Q14149, (Mouse) F7BJB9
Entrez Gene ID: (Human) 23515, (Rat) 304074, (Mouse) 338467
Performance Guarantee
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn more
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support