Invitrogen

OGT Polyclonal Antibody

View all (19) OGT antibodies
Datasheet
Protocols
Questions & Answers
Datasheet
Protocols
Questions & Answers

Product Details

PA5-95319

Applications
Tested Dilution
Publications

Western Blot (WB)

0.1-0.5 µg/mL
-

Immunohistochemistry (Paraffin) (IHC (P))

0.5-1 µg/mL
-

Immunocytochemistry (ICC/IF)

2 µg/mL
-

Flow Cytometry (Flow)

1-3 µg/1x10^6 cells
-
Product Specifications

Species Reactivity

Human, Mouse, Rat

Host/Isotype

Rabbit / IgG

Class

Polyclonal

Type

Antibody

Immunogen

A synthetic peptide corresponding to a sequence at the C-terminus of human OGT (1008-1046aa NTKQYTMELERLYLQMWEHYAAGNKPDHMIKPVEVTESA).
View immunogen

Conjugate

Unconjugated Unconjugated Unconjugated

Form

Lyophilized

Concentration

500 µg/mL

Purification

Affinity chromatography

Storage buffer

PBS with 5mg BSA

Contains

0.05mg sodium azide

Storage conditions

-20°C

Shipping conditions

Ambient (domestic); Wet ice (international)

RRID

AB_2807122

Product Specific Information

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

Positive Control - WB: human Hela whole cell, human PC-3 whole cell, human A431 whole cell, human A549 whole cell, human Caco-2 whole cell, human K562 whole cell, rat heart tissue, mouse heart tissue. IHC: mouse intestine tissue, rat intestine tissue, human gastric cancer tissue, human pancreatic cancer tissue, rat pancreas tissue. ICC/IF: A431 cell. Flow: U937 cell, RAW2647 cell.|Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

Target Information

This gene encodes a glycosyltransferase that catalyzes the addition of a single N-acetylglucosamine in O-glycosidic linkage to serine or threonine residues. Since both phosphorylation and glycosylation compete for similar serine or threonine residues, the two processes may compete for sites, or they may alter the substrate specificity of nearby sites by steric or electrostatic effects. The protein contains multiple tetratricopeptide repeats that are required for optimal recognition of substrates. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.

For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

References (0)

Have you cited this product in a publication?
Let us know so we can reference it here.
Cite this product

Bioinformatics

Protein Aliases: FLJ23071; MGC22921; O linked N-acetylglucosamine transferase; o-glcnac transferase; O-GlcNAc transferase p110 subunit; O-GlcNAc transferase subunit p110; O-linked N-acetylglucosamine (GlcNAc) transferase (UDP-N-acetylglucosamine:polypeptide-N-acetylglucosaminyl transferase); O-linked N-acetylglucosamine transferase 110 kDa subunit; OGT; UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit; UDP-N-acetylglucosamine:polypeptide-N-acetylglucosaminyl transferase; uridinediphospho-N-acetylglucosamine:polypeptide beta-N-acetylglucosaminyl transferase

View more View less

Gene Aliases: 1110038P24Rik; 4831420N21Rik; AI115525; HINCUT-1; HRNT1; O-GLCNAC; OGT; Ogtl

View more View less

UniProt ID: (Human) O15294, (Mouse) Q8CGY8, (Rat) P56558

View more View less

Entrez Gene ID: (Human) 8473, (Mouse) 108155, (Rat) 26295

View more View less

Function(s)
protein binding phosphatidylinositol-3,4,5-trisphosphate binding enzyme activator activity transcription factor binding acetylglucosaminyltransferase activity protein N-acetylglucosaminyltransferase activity protein domain specific binding peptide binding histone acetyltransferase activity (H4-K5 specific) histone acetyltransferase activity (H4-K8 specific) histone acetyltransferase activity (H4-K16 specific) monosaccharide binding protein O-GlcNAc transferase activity catalytic activity N-acetyltransferase activity lipid binding transferase activity transferase activity, transferring glycosyl groups
Process(es)
negative regulation of protein phosphorylation positive regulation of protein phosphorylation glucosamine metabolic process regulation of glycolytic process protein O-linked glycosylation apoptotic process positive regulation of gene expression negative regulation of peptidyl-threonine phosphorylation chromatin modification positive regulation of granulocyte differentiation negative regulation of protein ubiquitination response to insulin circadian regulation of gene expression negative regulation of peptidyl-serine phosphorylation regulation of Rac protein signal transduction positive regulation of catalytic activity histone H4-K5 acetylation histone H4-K8 acetylation histone H4-K16 acetylation positive regulation of cell size positive regulation of proteolysis positive regulation of transcription from RNA polymerase II promoter regulation of insulin receptor signaling pathway phosphatidylinositol-mediated signaling intracellular distribution of mitochondria rhythmic process positive regulation of histone H3-K4 methylation negative regulation of cell death positive regulation of histone H3-K27 methylation protein homotrimerization protein heterotrimerization cellular response to lipopolysaccharide cellular response to retinoic acid cellular response to glucose stimulus histone H3-K4 trimethylation negative regulation of protein targeting to membrane regulation of gluconeogenesis involved in cellular glucose homeostasis negative regulation of cellular response to hypoxia positive regulation of protein localization to nucleus positive regulation of reactive oxygen species biosynthetic process signal transduction response to nutrient forebrain development cellular response to insulin stimulus cellular response to toxic substance
guarantee_icon

Performance Guarantee

If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*

Learn more
help_icon

We're here to help

Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

Contact tech support