Search Thermo Fisher Scientific
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
FIGURE: 1 / 6
PPT1 Antibody (MA5-49231) in IHC (P)
Immunohistochemistry analysis of PPT1 in paraffin-embedded section of human intestinal cancer tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. Samples were incubated with PPT1 Monoclonal antibody (Product # MA5-49231) using a dilution of 1 μg/mL overnight at 4°C. Biotinylated goat anti-mouse IgG was... View More
Product Details
MA5-49231
Applications
Tested Dilution
Publications
Product Specifications
Species Reactivity
Human
Host/Isotype
Mouse
/ IgG2b
Class
Monoclonal
Type
Antibody
Clone
10F3
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human PPT1 (191-224aa KEDVYRNHSIFLADINQERGINESYKKNLMALKK).
Conjugate
Form
Lyophilized
Concentration
500 µg/mL
Purification
Antigen affinity chromatography
Storage buffer
PBS with 4mg trehalose
Contains
0.05mg sodium azide
Storage conditions
-20°C
Shipping conditions
Wet ice
RRID
AB_3074889
Product Specific Information
Adding 0.2 mL of distilled water will yield a concentration of 500 µg/mL.
Immunogen sequence is different from the related mouse and rat sequences by four amino acids.
Positive Control - WB: human K562 whole cell, human HepG2 whole cell, human Hela whole cell. IHC: human intestinal cancer tissue, human lung cancer tissue, human mammary cancer tissue. Flow: THP-1 cell.|Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.
Target Information
The protein encoded by this gene is a small glycoprotein involved in the catabolism of lipid-modified proteins during lysosomal degradation. The encoded enzyme removes thioester-linked fatty acyl groups such as palmitate from cysteine residues. Defects in this gene are a cause of infantile neuronal ceroid lipofuscinosis 1 (CLN1, or INCL) and neuronal ceroid lipofuscinosis 4 (CLN4). Two transcript variants encoding different isoforms have been found for this gene.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: 3.1.2.22; ceroid-palmitoyl-palmitoyl-protein thioesterase 1; Palmitoyl-protein hydrolase 1; Palmitoyl-protein thioesterase 1; PPT-1
Gene Aliases: CLN1; INCL; PPT; PPT1
UniProt ID: (Human) P50897
Entrez Gene ID: (Human) 5538
protein depalmitoylation
receptor-mediated endocytosis
pinocytosis
lysosomal lumen acidification
chemical synaptic transmission
neurotransmitter secretion
nervous system development
brain development
visual perception
grooming behavior
associative learning
adult locomotory behavior
protein transport
lipid catabolic process
sphingolipid catabolic process
protein catabolic process
negative regulation of cell growth
membrane raft organization
regulation of phospholipase A2 activity
long-chain fatty-acyl-CoA biosynthetic process
negative regulation of apoptotic process
negative regulation of neuron apoptotic process
cellular protein catabolic process
positive regulation of receptor-mediated endocytosis
positive regulation of pinocytosis
neuron development
regulation of synapse structure or activity
response to stimulus
cofactor transport
cofactor metabolic process
Performance Guarantee
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn more
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support